>gi|5729738|ref|np_006689.1| bladder cancer-associated protein [homo sapiens]
myclqwllpvllipkplnpalwfshsmfmgfyllsfllerkpcticalvflaalflicyscwgncflyhc
sdsplpesahdpgvvgt
You can't model this sequence through homology modeling coz it has no related structure so, using try loop modeling, ab-initio, threading and fold recognition methods. find the list of software's in link below:
http://en.wikipedia.org/wiki/List_of_protein_structure_prediction_software
Anita Tripathi thank for your reply
I believe Rosetta will help you in this. This is a tool that performs ab initio modeling
Above sequence by manual I know that its a LOOP only based on my concept we can design the structure based on the sequence or any other rule
I struck with generating topology for lipid membrane and polymer through gromacs. I tried different force filed like lipid force filed etc. I am unable to generate topology file through gmx...
05 June 2016 8,841 2 View
I tried several values in this process pme_order = 8 / fourierspacing = 0.48 vs pme_order =10 / fourierspacing = 1.20 try comparing to the the default: pme_order = 4 / fourierspacing =...
04 May 2013 5,947 0 View
Can anyone tell me how to model Homodimer from target sequence through Modeller? It means A and B chain
01 February 2013 2,450 4 View
I am modeling three structures using MODELLER, now I want to merge these three model structures to form a unique model. Can anyone suggest any open-source tools or online servers other than...
01 February 2013 3,540 0 View
Using Biojava, I want to read multiple sequences and make an alignment for distance tree. I tried using cook book but I am getting an error, can anyone help me with this problem? import...
01 February 2013 1,130 3 View
Can anyone give me the best molecular dynamics parameters file for GROMACS?
01 February 2013 3,046 15 View
I am modeling three structures using MODELLER, I am trying to merge these three model structures to form a unique model through but it is giving an error: rdpdb___303E> No atoms were read from...
01 February 2013 3,968 2 View
Is it possible to design a drug compound to suppress the mutation in the DNA ,I have the logic to hold the drug at particular site in mutated DNA, am I right ?
08 September 2012 4,957 5 View
"PUBLISHING IN A SCOPUS JOURNAL" Researchers are now at a cross road. The critical need to publish in a Scopus or ISI, etc journal is ever vital. Journal Publication fees must be submitted....
10 August 2024 8,621 1 View
Hello everyone, I am currently developing a thesis proposal and would appreciate your input on its viability and how to effectively carry it out. My proposed topic is: "Does the perceived threat...
10 August 2024 8,992 0 View
Who will bear moral responsibility for the deaths of thousands of people in the event of an earthquake? Weeks and months remain before the onset of strong earthquakes that bring death to...
08 August 2024 6,134 12 View
There are a huge number of methods for studying objects in space, according to the senses (and not only). Mechanical, thermal, optical, acoustic, electrical, magnetic, based on particle beams,...
06 August 2024 7,102 0 View
After immunohistochemistry of previously fixed in PFA and EtOH and then frozen 20 μm sections of zebrafish brain, DAPI staining is very weak (right) compared to the same sections stained without...
05 August 2024 9,637 2 View
I aim to be as skeptical as possible regarding whether a pair of orthologous genes results in the same phenotype in their different but related bacterial organisms under similar environmental...
05 August 2024 6,787 4 View
Brain and body mass together are positively correlated with lifespan (Hofman 1993). The duration of neural development is one of the best predictors of brain size, and conception is the best...
05 August 2024 6,247 3 View
In the case of a wound l recurrence after radical breast cancer and sentinel lymph node biopsy. Are the sentinel lymph node procedure recommended? If no axillary lymph node dissection was not...
05 August 2024 8,056 1 View
Regarding a model for simulating battery charge and discharge, what do you consider to be high fidelity? What is the acceptable percentage of error (regardless of the metric)? Could you suggest...
03 August 2024 5,358 0 View
Hi RG family. My team and I are working on some SCOPUS publications and we need co-authors who are willing and capable of undertaking both qualitative and quantitative-based studies. The scope...
02 August 2024 7,843 0 View