9 Questions 27 Answers 0 Followers
Questions related from Shameer Pillarisetti
I struck with generating topology for lipid membrane and polymer through gromacs. I tried different force filed like lipid force filed etc. I am unable to generate topology file through gmx...
06 June 2016 8,819 2 View
I tried several values in this process pme_order = 8 / fourierspacing = 0.48 vs pme_order =10 / fourierspacing = 1.20 try comparing to the the default: pme_order = 4 / fourierspacing =...
05 May 2013 5,915 0 View
Can anyone tell me how to model Homodimer from target sequence through Modeller? It means A and B chain
02 February 2013 2,425 4 View
I am modeling three structures using MODELLER, I am trying to merge these three model structures to form a unique model through but it is giving an error: rdpdb___303E> No atoms were read from...
02 February 2013 3,939 2 View
I am modeling three structures using MODELLER, now I want to merge these three model structures to form a unique model. Can anyone suggest any open-source tools or online servers other than...
02 February 2013 3,509 0 View
Can anyone give me the best molecular dynamics parameters file for GROMACS?
02 February 2013 3,011 15 View
Using Biojava, I want to read multiple sequences and make an alignment for distance tree. I tried using cook book but I am getting an error, can anyone help me with this problem? import...
02 February 2013 1,102 3 View
Is it possible to design a drug compound to suppress the mutation in the DNA ,I have the logic to hold the drug at particular site in mutated DNA, am I right ?
09 September 2012 4,929 5 View
>gi|5729738|ref|np_006689.1| bladder cancer-associated protein [homo sapiens] myclqwllpvllipkplnpalwfshsmfmgfyllsfllerkpcticalvflaalflicyscwgncflyhc sdsplpesahdpgvvgt
08 August 2012 7,108 4 View
