Protein-modeling tools.

Shameer Pillarisetti @Shameer_Pillarisetti

02 February 2013 0 4K Report

I am modeling three structures using MODELLER, now I want to merge these three model structures to form a unique model. Can anyone suggest any open-source tools or online servers other than MODELLER and 'Swiss Model'.

Badges
Science topic

More Shameer Pillarisetti's questions See All

How to carry out my experiment on lipid Membrane and Polymer simulation studies with gromacs?

I struck with generating topology for lipid membrane and polymer through gromacs. I tried different force filed like lipid force filed etc. I am unable to generate topology file through gmx...

05 June 2016 8,841 2 View

Can anyone help with setting PME grid dimensions?

I tried several values in this process pme_order = 8 / fourierspacing = 0.48 vs pme_order =10 / fourierspacing = 1.20 try comparing to the the default: pme_order = 4 / fourierspacing =...

04 May 2013 5,947 0 View

How to model Homodimers

Can anyone tell me how to model Homodimer from target sequence through Modeller? It means A and B chain

01 February 2013 2,450 4 View

Biojava code for multiple sequences alignment and distance tree.

Using Biojava, I want to read multiple sequences and make an alignment for distance tree. I tried using cook book but I am getting an error, can anyone help me with this problem? import...

01 February 2013 1,130 3 View

Regarding .mdp file for GROMACS

Can anyone give me the best molecular dynamics parameters file for GROMACS?

01 February 2013 3,046 15 View

Error in MODELLER - merging structures.

I am modeling three structures using MODELLER, I am trying to merge these three model structures to form a unique model through but it is giving an error: rdpdb___303E> No atoms were read from...

01 February 2013 3,968 2 View

Is it possible to design a drug compound to suppress the mutation in the DNA?

Is it possible to design a drug compound to suppress the mutation in the DNA ,I have the logic to hold the drug at particular site in mutated DNA, am I right ?

08 September 2012 4,957 5 View

Unable to get a structure for a displayed sequence

>gi|5729738|ref|np_006689.1| bladder cancer-associated protein [homo sapiens] myclqwllpvllipkplnpalwfshsmfmgfyllsfllerkpcticalvflaalflicyscwgncflyhc sdsplpesahdpgvvgt

07 August 2012 7,133 4 View

Which Scopus Journal provides the most affordable fees?

"PUBLISHING IN A SCOPUS JOURNAL" Researchers are now at a cross road. The critical need to publish in a Scopus or ISI, etc journal is ever vital. Journal Publication fees must be submitted....

10 August 2024 8,621 1 View

Seeking Advice on Viability and Execution of Undergraduate Thesis Topic?

Hello everyone, I am currently developing a thesis proposal and would appreciate your input on its viability and how to effectively carry it out. My proposed topic is: "Does the perceived threat...

10 August 2024 8,992 0 View

Who will be moral responsible for the death of thousands of people in the event of an earthquake?

Who will bear moral responsibility for the deaths of thousands of people in the event of an earthquake? Weeks and months remain before the onset of strong earthquakes that bring death to...

08 August 2024 6,134 12 View

GC-MS retention index prediticon?

Hello experts, Does anyone know any free software about retention index prediction ?

08 August 2024 7,403 2 View

Are there any instruments for studying time similar to the way it is in space?

There are a huge number of methods for studying objects in space, according to the senses (and not only). Mechanical, thermal, optical, acoustic, electrical, magnetic, based on particle beams,...

06 August 2024 7,102 0 View

Weak DAPI staining after immunohistochemistry - how to improve?

After immunohistochemistry of previously fixed in PFA and EtOH and then frozen 20 μm sections of zebrafish brain, DAPI staining is very weak (right) compared to the same sections stained without...

05 August 2024 9,637 2 View

Why did the authors extrapolate a phenotype that they experimentally proved in one bacterial strain across the whole genus of the organism?

I aim to be as skeptical as possible regarding whether a pair of orthologous genes results in the same phenotype in their different but related bacterial organisms under similar environmental...

05 August 2024 6,787 4 View

The Curse of Evolution and Complexity?

Brain and body mass together are positively correlated with lifespan (Hofman 1993). The duration of neural development is one of the best predictors of brain size, and conception is the best...

05 August 2024 6,247 3 View

In the case of a wound l recurrence after radical breast cancer and sentinel lymph node biopsy. Are the sentinel lymph node procedure recommended?

In the case of a wound l recurrence after radical breast cancer and sentinel lymph node biopsy. Are the sentinel lymph node procedure recommended? If no axillary lymph node dissection was not...

05 August 2024 8,056 1 View

Regarding a model for simulating battery charge and discharge, what do you consider to be high fidelity?

Regarding a model for simulating battery charge and discharge, what do you consider to be high fidelity? What is the acceptable percentage of error (regardless of the metric)? Could you suggest...

03 August 2024 5,358 0 View