Can anyone tell me how to model Homodimer from target sequence through Modeller? It means A and B chain
If you have a dimer template and model a dimer simply add a "/" sign in your alignment file.
i.e.
{
>P1;template header
Modeling Delimiters
Template sequence of chain A
/
Template sequence of Chain B *
>P1;target header
Target sequence of chain A
Target sequence of Chain B *
}
Thats all.
Thank Rajnikant Namdeo for lovely answer
No its not working see my alignment file its right i place "/" between the chains
>p1;440919431
sequence:440919431:1:a:151:a:polyprotein, partial [dengue virus 3]:dengue virus 3:2.00:-1.00
vstgsqlakrfskgllngqgpmklvmafiaflrflaipptagvlarwgtfkksgaikvlkgfkkeisnmlsi
inkrkktslclmmilpaalafhltsrdgeprmivgknergksllfktasginmctliamdlgemcddtvtyk
cphitev*
sequence:440919431:1:b:78:b:polyprotein, partial [dengue virus 3]:dengue virus 3:2.00:-1.00
>p1;seqm1
structurex:seqm1:1:a:78:a: : : :
inkrkk------------------------------------------------------------------
-------*
structurex:seqm1:1:b:78:b: : : :
>p1;structure
structurex:structure:1: :151: : : : :
No dear not that way. See my ans carefully.
>P1
Template Seq of Chain A (No terminaion and no PIR description after )
Template Seq of Chain B *
Target Seq of Chain A (No terminaion and no PIR description
Target Seq of Chain B *
I struck with generating topology for lipid membrane and polymer through gromacs. I tried different force filed like lipid force filed etc. I am unable to generate topology file through gmx...
05 June 2016 8,841 2 View
I tried several values in this process pme_order = 8 / fourierspacing = 0.48 vs pme_order =10 / fourierspacing = 1.20 try comparing to the the default: pme_order = 4 / fourierspacing =...
04 May 2013 5,947 0 View
I am modeling three structures using MODELLER, now I want to merge these three model structures to form a unique model. Can anyone suggest any open-source tools or online servers other than...
01 February 2013 3,540 0 View
Using Biojava, I want to read multiple sequences and make an alignment for distance tree. I tried using cook book but I am getting an error, can anyone help me with this problem? import...
01 February 2013 1,130 3 View
Can anyone give me the best molecular dynamics parameters file for GROMACS?
01 February 2013 3,046 15 View
I am modeling three structures using MODELLER, I am trying to merge these three model structures to form a unique model through but it is giving an error: rdpdb___303E> No atoms were read from...
01 February 2013 3,968 2 View
Is it possible to design a drug compound to suppress the mutation in the DNA ,I have the logic to hold the drug at particular site in mutated DNA, am I right ?
08 September 2012 4,957 5 View
>gi|5729738|ref|np_006689.1| bladder cancer-associated protein [homo sapiens] myclqwllpvllipkplnpalwfshsmfmgfyllsfllerkpcticalvflaalflicyscwgncflyhc sdsplpesahdpgvvgt
07 August 2012 7,133 4 View
Hello experts, Does anyone know any free software about retention index prediction ?
08 August 2024 7,403 2 View
Molecular docking software/ websites?
02 August 2024 8,704 7 View
I created a file with my outgroup and ingroup species using Beauti, ran it in BEAST, viewed it in Tracer, and then used TreeAnnotator to create a file that I imported into RASP. Could someone...
28 July 2024 2,979 1 View
I had a problem for so long. I could easily delete elements in ABAQUS implicit solver but I needed to use VUMAT so I had to have Explicit solution but the element did not disappear for so long. I...
23 July 2024 10,032 0 View
I am reaching out to seek your valuable advice and recommendations regarding the best software tools to use for this research. Specifically, I am looking for software with a user-friendly...
22 July 2024 3,794 1 View
Hey all, I need help testing for multivariate outliers using STATA for my master thesis. The literature recommends the Minimum Covariance Determinant (MCD) (Verardi & Dehon, 2010). I found the...
22 July 2024 8,821 2 View
Dear Researchers, My question is associated with the "MDCI" method in Orca. Please let me clarify my question using a simple example: Suppose we are going to perform CBS extrapolation using "!...
21 July 2024 1,632 0 View
What type of experimental design do l use and what statistical tools do l use for the hypothesis. What is the position of control group in the analysis?. Thanks
18 July 2024 3,581 3 View
im studing gaussian 16 with reading paper about I-131 Metaiodobenzylguanidine in the paper "In a similar vein, nuclear magnetic resonance shielding values were investigated using the widely...
16 July 2024 6,040 4 View
I am a 3rd year Computer Science student currently writing our Bachelor's thesis about finding diverse k-shortest paths in pedestrian networks. We have chosen 3 local areas as our proposed...
15 July 2024 4,289 0 View