How to quantify degree of oxidation through NMR ?

Shameer Pillarisetti @Shameer-Pillarisetti

16 December 2017 0 4K Report

In which way I have to quantify the sodium alginate degree of oxidation through proton NMR

Badges
Science topic

More Shameer Pillarisetti's questions See All

Where should I mainly focus on , to get high efficiency, breakdown torque, power factor in 3 phase squirrel cage induction motor for EV ?

We are designing 3 phase squirrel cage induction motor for EV, Our main aim is to get high efficiency, power factor,and breakdown torque... How can I design by satisfying these three...

14 October 2022 9,396 2 View

What are the best environmentally benign/green solvents to dissolve PMMA?

I would like to use environmentally benign solvents for dissolution of PMMA to make thin films and coatings.

10 November 2019 9,003 4 View

Any one help me to collect this reference ?

Bhattacharya S K, Parikh A K, Debnath PK., Pandey V B , Neogy N. 1973. Pharmacological studies with the alkaloids of Costus speciosus (kemuka) C. Journal of Research in Indian Medicine. 8:...

15 January 2017 8,765 4 View

How to carry out my experiment on lipid Membrane and Polymer simulation studies with gromacs?

I struck with generating topology for lipid membrane and polymer through gromacs. I tried different force filed like lipid force filed etc. I am unable to generate topology file through gmx...

12 June 2016 985 2 View

What is the Rationale for 1:2 ratio in Case Control studies?

Hello Researchers, What are epidemiological and Bio statistics rationale for considering 1: 2 ratio in a case control study? How do I chose two controls per 1 case? pls Help me, Shameer

21 December 2014 8,142 12 View

Can anyone suggest methods to analyse the Tracksphere (Locomotion Compensator) data?

I have done tracksphere experiments of a pest caterpillar with Syntech Tracksphere LC 300. I have recorded the responses of the caterpillar towards 6 different plant leaf extracts, extracted in...

19 July 2014 9,723 3 View

Social Networking Marketing Case Studies?

I'm looking for marketing techniques and market research case studies for social network startups. I'm basically interested in how the social networks like facebook, linkedin, researchgate, etc...

14 January 2014 3,928 2 View

Error in MODELLER - merging structures.

I am modeling three structures using MODELLER, I am trying to merge these three model structures to form a unique model through but it is giving an error: rdpdb___303E> No atoms were read from...

12 February 2013 6,127 2 View

Is it possible to design a drug compound to suppress the mutation in the DNA?

Is it possible to design a drug compound to suppress the mutation in the DNA ,I have the logic to hold the drug at particular site in mutated DNA, am I right ?

02 September 2012 5,390 4 View

Unable to get a structure for a displayed sequence

>gi|5729738|ref|np_006689.1| bladder cancer-associated protein [homo sapiens] myclqwllpvllipkplnpalwfshsmfmgfyllsfllerkpcticalvflaalflicyscwgncflyhc sdsplpesahdpgvvgt

30 August 2012 1,833 3 View

Why do paired electrons atoms produce no magnetic field lines?

If you think of electrons with spin as bar magnets, you know bar magnets of opposite polarity as long as they're not occupying the same spatial location don't cancel out each other's magnetic...

03 August 2024 3,927 2 View

How to correctly use the UTE and ZTE pulse sequences in Bruker's ParaVision software?

I am using a Bruker 600M solid-state NMR spectrometer with a Micro 2.5 microimaging system. The test sample is a tube of 1M LiCl aqueous solution, and the nucleus detected is 1H. I am trying to...

01 August 2024 9,227 1 View

Mossbauer spectroscopy Co0.6Mn0.4Fe2O4 MNPs?

Following curve related to Co0.6Mn0.4Fe2O4 Magnetic nanoparticles with extra phase a-Fe2O3. I will appreciate to help me to interpretation this spectroscopy, especially the blue line.

31 July 2024 9,140 2 View

IHC profiler in image j software. has anyone used it to quantify nuclear DAB positivity?

Dear researchers. I tried using the IHC PROFILER in image j to quantify nuclear DAB staining. I followed the instructions in the original article by "Varghese F, Bukhari AB, Malhotra R, De A...

29 July 2024 2,229 0 View

What is single absorption ESR spectroscopy ?

In the context of Electron Spin Resonance (ESR) spectroscopy, under what conditions is an absorption spectrum considered to be a single absorption spectrum?

25 July 2024 2,325 1 View

How many events should be counted for the analysis of apoptosis with nuclear staining with Hoechst 33342 whit microscopy ?

Greeting How many events should be counted for the analysis of apoptosis with nuclear staining with Hoechst 33342 whit microscopy ? Are 100 events count sufficient and three repetitions for...

25 July 2024 7,520 0 View

Sodium azide in immunohistochemistry?

Hello everyone, A collaborator sent us his protocol in order to be able to use his immunohistochemistry kits. But one step contains PBS + 0.3% H2O2 + 0.1% sodium azide. Knowing the dangerousness...

23 July 2024 6,314 3 View

What is the physical meaning of the magnetic scalar potential?

In cases where the rotational of the magnetic field H is zero, we can define this field as the gradient of a scalar function defined as the magnetic scalar potential (similar to the electric...

21 July 2024 9,633 4 View

In Chip-seq, what will be the impact of adding proteinase K before removing the magnetic beads?

I was following this chip-seq protocol https://www.cellsignal.com/products/chip-kits-reagents/plus-sonication-chromatin-ip-kit/56383 what will be the consequence if on the following state "VI....

20 July 2024 5,612 0 View

Why electrical charge on the moving plate increase?

Hi, everyone This figure depicts a simulation of an electrostatic energy harvesting system in COMSOL Multiphysics software. My question is regarding the relationship between the changes in...

19 July 2024 4,694 4 View