What are the best environmentally benign/green solvents to dissolve PMMA?

I would like to use environmentally benign solvents for dissolution of PMMA to make thin films and coatings.

10 November 2019 8,847 4 View

How to carry out my experiment on lipid Membrane and Polymer simulation studies with gromacs?

I struck with generating topology for lipid membrane and polymer through gromacs. I tried different force filed like lipid force filed etc. I am unable to generate topology file through gmx...

12 June 2016 884 2 View

What is the Rationale for 1:2 ratio in Case Control studies?

21 December 2014 7,927 12 View

Error in MODELLER - merging structures.

I am modeling three structures using MODELLER, I am trying to merge these three model structures to form a unique model through but it is giving an error: rdpdb___303E> No atoms were read from...

12 February 2013 6,032 2 View

Is it possible to design a drug compound to suppress the mutation in the DNA?

Is it possible to design a drug compound to suppress the mutation in the DNA ,I have the logic to hold the drug at particular site in mutated DNA, am I right ?

02 September 2012 5,292 4 View

Unable to get a structure for a displayed sequence

>gi|5729738|ref|np_006689.1| bladder cancer-associated protein [homo sapiens] myclqwllpvllipkplnpalwfshsmfmgfyllsfllerkpcticalvflaalflicyscwgncflyhc sdsplpesahdpgvvgt

30 August 2012 1,728 3 View

How do I determine the degree of polymerization of PEG 400 based on NMR integration?

Hello, I am working on the photocatalytic degradation of PEG 400. I would like to know if it's possible to determine the degree on polymerization based on NMR integration, or by the MW of the...

02 March 2021 6,186 3 View

Do you know any MR image dataset?

I would like to research on MR images (0.5T and 3T). Can you please suggest some websites that I can download dataset including both 0.5T and 3T MR images? Thank you.

02 March 2021 7,735 3 View

Precipitate after adding laemmli buffer to protein solution containing Potassium Acetate?

Hi, I am running a size exclusion chromatography experiment with a buffer containing Potassium Acetate as a salt. I analyse these fractions through SDS-PAGE. After boiling my SEC fractions in...

01 March 2021 2,622 3 View

What could be some reasons why unstimulated monocytes are getting activated?

Im doing PBMC isolation -> CD14+ enrichment using magnetic beads -> stimulation setup. My negative control is just cells in cRPMI but they seem to get activated over and over again.

28 February 2021 7,883 3 View

Does the circuit modeling for planar monopole antennas using Foster canonical forms give good approximation?

Hi researchers, I am searching for some accurate way to do the circuit modeling of planar CPW-fed monopole antennas. I have gone through the literature where mostly circuit modeling is done using...

28 February 2021 7,016 1 View

How to include original NMR data in a manuscript?

hello. i am junior researcher. I received a comment from a reviewer that he could not find NMR data in my submitted paper. I had included the NMR graph with explanation and formula to calculate...

27 February 2021 734 4 View

How to prepare electrolyte of NaClO4 salt for Na-ion battery? Any problem with this salt?

Hello, I am trying to make anode for Na-ion batteries. I have no experience with preparation of the electrolyte for any batteries. NaClO4 salt are available and I am planning to use EC:PC as...

21 February 2021 8,132 1 View

How to Study a proton NMR of Graphene prepared by Electrochemical Exfoliation technique?

I performed a Proton NMR of graphene powder prepared by electrochemical exfoliation technique. It shows some peaks. But I can't understand it.

21 February 2021 8,947 3 View

Is There are any idea to achieve H NMR signals for swollen compound ??

the samples are not completely soluble - just swelled the solvents that's mean the sample may be partially soluble any suggestion, please

16 February 2021 8,801 3 View

How to detect uv vis spectrum of nanoparticle under 300nm?

I try to make the indium nanoparticle and check the uv vis spectrum. I heard that In nanoparticle has surface plasmon resonance peak at 200~300nm. But most of solvent has absorption peak under...

14 February 2021 6,950 15 View