Any one help me to collect this reference ?

More Shameer Poovachal's questions See All

Where should I mainly focus on , to get high efficiency, breakdown torque, power factor in 3 phase squirrel cage induction motor for EV ?

We are designing 3 phase squirrel cage induction motor for EV, Our main aim is to get high efficiency, power factor,and breakdown torque... How can I design by satisfying these three...

14 October 2022 9,396 2 View

What are the best environmentally benign/green solvents to dissolve PMMA?

I would like to use environmentally benign solvents for dissolution of PMMA to make thin films and coatings.

10 November 2019 9,003 4 View

How to quantify degree of oxidation through NMR ?

In which way I have to quantify the sodium alginate degree of oxidation through proton NMR

15 December 2017 4,082 0 View

How to carry out my experiment on lipid Membrane and Polymer simulation studies with gromacs?

I struck with generating topology for lipid membrane and polymer through gromacs. I tried different force filed like lipid force filed etc. I am unable to generate topology file through gmx...

12 June 2016 985 2 View

What is the Rationale for 1:2 ratio in Case Control studies?

Hello Researchers, What are epidemiological and Bio statistics rationale for considering 1: 2 ratio in a case control study? How do I chose two controls per 1 case? pls Help me, Shameer

21 December 2014 8,142 12 View

Can anyone suggest methods to analyse the Tracksphere (Locomotion Compensator) data?

I have done tracksphere experiments of a pest caterpillar with Syntech Tracksphere LC 300. I have recorded the responses of the caterpillar towards 6 different plant leaf extracts, extracted in...

19 July 2014 9,723 3 View

Social Networking Marketing Case Studies?

I'm looking for marketing techniques and market research case studies for social network startups. I'm basically interested in how the social networks like facebook, linkedin, researchgate, etc...

14 January 2014 3,928 2 View

Error in MODELLER - merging structures.

I am modeling three structures using MODELLER, I am trying to merge these three model structures to form a unique model through but it is giving an error: rdpdb___303E> No atoms were read from...

12 February 2013 6,127 2 View

Is it possible to design a drug compound to suppress the mutation in the DNA?

Is it possible to design a drug compound to suppress the mutation in the DNA ,I have the logic to hold the drug at particular site in mutated DNA, am I right ?

02 September 2012 5,390 4 View

Unable to get a structure for a displayed sequence

>gi|5729738|ref|np_006689.1| bladder cancer-associated protein [homo sapiens] myclqwllpvllipkplnpalwfshsmfmgfyllsfllerkpcticalvflaalflicyscwgncflyhc sdsplpesahdpgvvgt

30 August 2012 1,833 3 View

Which Scopus Journal provides the most affordable fees?

"PUBLISHING IN A SCOPUS JOURNAL" Researchers are now at a cross road. The critical need to publish in a Scopus or ISI, etc journal is ever vital. Journal Publication fees must be submitted....

10 August 2024 8,621 1 View

Seeking Advice on Viability and Execution of Undergraduate Thesis Topic?

Hello everyone, I am currently developing a thesis proposal and would appreciate your input on its viability and how to effectively carry it out. My proposed topic is: "Does the perceived threat...

10 August 2024 8,992 0 View

Who will be moral responsible for the death of thousands of people in the event of an earthquake?

Who will bear moral responsibility for the deaths of thousands of people in the event of an earthquake? Weeks and months remain before the onset of strong earthquakes that bring death to...

08 August 2024 6,134 12 View

How to calculate CCS for Sodiated adduct ions and Multiply Charged Ions?

I'm currently working on calculating the collision cross section (CCS) for various ions, and I'm facing challenges when dealing with sodiated and multiply charged ions. Most of the resources I’ve...

08 August 2024 8,329 0 View

Are there any instruments for studying time similar to the way it is in space?

There are a huge number of methods for studying objects in space, according to the senses (and not only). Mechanical, thermal, optical, acoustic, electrical, magnetic, based on particle beams,...

06 August 2024 7,102 0 View

How do soil microflora interact with plant roots and influence plant nutrition, health, and productivity?

06 August 2024 9,618 3 View

In the case of a wound l recurrence after radical breast cancer and sentinel lymph node biopsy. Are the sentinel lymph node procedure recommended?

In the case of a wound l recurrence after radical breast cancer and sentinel lymph node biopsy. Are the sentinel lymph node procedure recommended? If no axillary lymph node dissection was not...

05 August 2024 8,056 1 View

Regarding a model for simulating battery charge and discharge, what do you consider to be high fidelity?

Regarding a model for simulating battery charge and discharge, what do you consider to be high fidelity? What is the acceptable percentage of error (regardless of the metric)? Could you suggest...

03 August 2024 5,358 0 View

Interested in a SCOPUS collaboration?

Hi RG family. My team and I are working on some SCOPUS publications and we need co-authors who are willing and capable of undertaking both qualitative and quantitative-based studies. The scope...

02 August 2024 7,843 0 View

Interested in a SCOPUS collaboration?

Hi RG family. My team and I are working on some SCOPUS publications and we need co-authors who are willing and capable of undertaking both qualitative and quantitative-based studies. The scope of...

02 August 2024 8,572 0 View

Shameer Poovachal

Sir,

Thank you. Actually I tried to editors. But I can't get a valid Id.

Riki P Tailor

Dear Shameersir, I have also tried but not got it. There are lots of cross reference available. I am also agree with Tanwir sir.

Rohit Sharma

Dear shameer,

I hope you may have already found the reference...i can provide you the same if u still require it..since m out of my workplace..I'll try to send paper to u as i reach my office.

Please give me the refernce