5 Questions 10 Answers 0 Followers
Questions related from Shameer Pillarisetti
In which way I have to quantify the sodium alginate degree of oxidation through proton NMR
16 December 2017 4,070 0 View
I struck with generating topology for lipid membrane and polymer through gromacs. I tried different force filed like lipid force filed etc. I am unable to generate topology file through gmx...
13 June 2016 965 2 View
I am modeling three structures using MODELLER, I am trying to merge these three model structures to form a unique model through but it is giving an error: rdpdb___303E> No atoms were read from...
13 February 2013 6,116 2 View
Is it possible to design a drug compound to suppress the mutation in the DNA ,I have the logic to hold the drug at particular site in mutated DNA, am I right ?
03 September 2012 5,377 4 View
>gi|5729738|ref|np_006689.1| bladder cancer-associated protein [homo sapiens] myclqwllpvllipkplnpalwfshsmfmgfyllsfllerkpcticalvflaalflicyscwgncflyhc sdsplpesahdpgvvgt
31 August 2012 1,816 3 View