How to improve band quality in S-1 nuclease PFGE?

21 December 2017 1 7K Report

I did PFGE with S-1 nuclease digestion of some ESBL-producing E. coli isolates. Some isolates showed good bands but some isolates showed very faint bands after gel electrophoresis. So, how to improve faint band in this case, if someone have better idea, kindly suggest me.

Mohammad Arif Hossain

Use more purified DNA and avoid excessive buffers and electrolytes...

Badges
Science topic

Similar topics
Correction

More Azimun Nahar's questions See All

InderScience submission Help?

In the InderScience submission, I need the names and details of 4 international experts (I am from India, so at least 2 must be from outside country) I am trying to submit an article that is based...

11 March 2024 9,402 0 View

How to solve big size cloning (5kb insert into 4.3kb vector) ?

Hello I am doing 5kb cloning. But unfortunately I am getting band in 3kb,can anyone tell me what is the exact reason to get at 3kb band? I have made primer in 4 fragment (approximately 1.25kb for...

07 June 2022 6,900 0 View

Why my protein is precipitating after purification?

Hello, I am trying to purify a recombinant his-tagged protein (MW: 29.5 kd, pI:5.7, mostly composed of beta strands). It has been expressed from BL21(DE3) competent cell. I am using 50 mM Tris,...

14 December 2021 1,077 5 View

How to carry out modified possion regression in spss/ R ?

i know how to carry out Poisson regression for count variable such as total number of children in spss but not modified Poisson regression

27 May 2020 6,044 0 View

How Training and Development help reshaping economy after pandemic situation?

Specially for different sectors different Training and development activities will boost up economic crisis. even those who lost their job like garments workers how we can utilise them by...

20 May 2020 1,991 3 View

I am loosing all my protein when I try to concentrate it. Can you please suggest me a anything about it?

Greetings! I am currently working with a kinase name Microtubule affinity regulating kinase 2( MARK2). Every time I purified this protein, I have never got a good yield. Usually after...

12 February 2020 1,798 2 View

Can anyone please suggest me an alternative of Thioanisol at cleavage/micro-cleavage cocktail?

Greetings! I am now working on a F-moc based peptide synthesis having following sequence: GFARVYMSRSSGWERPSGGNVKCKIGSTENLK (N terminal to C-terminal) For the cleavage/micro-cleavge, I need to...

09 February 2020 6,467 6 View

How to do apparatus setup for a photoaffinity labelling assay?

Our lab need to perform a photo-affinity labelling experiment for the first time. We do not have any sort of previous experience for this type of experiment and we are looking for how to set up...

20 August 2019 9,297 0 View

How can I increase HCO3 in Natural drinking water?

If the HCO3 concentration is low in natural water, then how can I increase HCO3 concentration

01 February 2016 3,740 8 View

Sterol staining in yeast ?

I am looking for alternative of Filipin staining for sterols which have higher or lower affinity to specific kind of sterols. Thanks

07 October 2015 8,789 0 View

H3K9Me2/3 western blots in S.pombe?

I have recently started working with heterochromatin . I am trying to quantify the H3K9Me levels but i am failing to do so. Sometimes i see faint duplex band . I do TCA Lysis and then follow up...

22 May 2024 2,071 2 View

Can the Andersen sampler be used to detect aerosolized MS2 on agar plates with E.coli on top?

Greetings, does anyone have experience using the Andersen 6-stage sampler to collect aerosolized MS2 bacteriophage? My idea is to place into the Andersen agar plates already with a layer of E.coli...

17 May 2024 5,793 3 View

Can you explain the difference observed between my PFGE and WGS results for E. coli comparison?

Recently i did PFGE and WGS comparison with the same set of E coli strains. In my mind, if PFGE give two different pulsotypes, it is sure that strains are not the same. But when i did WGS, i...

12 May 2024 8,107 2 View

Is there any way to determine the concentration of protein in a gel-ready protein sample?

I am performing western blot and recently i have been obtaining faint bands for the samples i had already run and had got darker bands. I wish to determine the concentration of protein in those...

08 May 2024 8,933 4 View

PFGE why there are no or few bands?

Hello, I am new in PFGE and started by checking Lambda ladder electrophoresis accordingly to BIO-Rad recomendations: -CHEF DR III -gel in 0.5x TBE, -recirculated at 14 °C. -Run time was 22...

18 March 2024 2,830 4 View

How can we improve the detection sensitivity of Western Blotting for proteins with low signal levels?

I have conducted several western blots to detect the expression of Zonula Occludens-1 (ZO-1), NCX-1, and PMCA1. However, I have observed that the expression levels of these proteins are very low,...

18 February 2024 3,064 7 View

How I can enhance my protein expression in E.coli BL21(DE3) ? How I can increase yield?

Hey there, currently I am working on threonine synthase enzyme of Leishmania. I have successfully cloned it into E.coli DH5alpha strain. I have also transformed it into E.coli BL21(DE3) strain. I...

02 February 2024 1,962 4 View

Why I am getting very bright primer dimers but faint colour PCR product?

Hi to all Hope you are doing well. I am amplifying Kan cassette in PkD4 plasmid with 40bp extensions in primers to knockout gene in MG1655 E.COLI by lambda red mutagenesis . the expected product...

21 January 2024 9,075 1 View

Why do I not see proteins from my exosome samples in the gel, even though the BCA assay shows I have proteins?

Hello, So I have been struggling to get a successful western blot using MIN6 derived EVs, and it has been a real struggle. Everytime I isolate my EVs, and after lysing them, I run the proteins in...

16 January 2024 1,975 6 View

Confusion about virus DNA PFGE image ?

This dot appeard instead a visible distinct band. the concentration of the DNA was 30 microgeam/ml Can you help me please if this is a band or not and why it appears like that ?

10 January 2024 4,187 3 View