Sterol staining in yeast ?

08 October 2015 0 9K Report

I am looking for alternative of Filipin staining for sterols which have higher or lower affinity to specific kind of sterols.

Thanks

Badges
Science topic

More Anubhav Singh Nahar's questions See All

InderScience submission Help?

In the InderScience submission, I need the names and details of 4 international experts (I am from India, so at least 2 must be from outside country) I am trying to submit an article that is based...

11 March 2024 9,402 0 View

How to select bed material along with flow during the modeling of local scour around the bridge pier in ANSYS FLUENT??

How to select bed material along with flow during the modeling of local scour around the bridge pier in ANSYS FLUENT?? Please provide some sources to tackle this issue.

26 January 2023 9,848 2 View

How to solve big size cloning (5kb insert into 4.3kb vector) ?

Hello I am doing 5kb cloning. But unfortunately I am getting band in 3kb,can anyone tell me what is the exact reason to get at 3kb band? I have made primer in 4 fragment (approximately 1.25kb for...

07 June 2022 6,900 0 View

Prevent evaporation loss from 96 well plate?

Hey, I am using 96 well plates to grow Bacteroides samples and tracking their OD using an automated plate reader. I have to take readings for a long period of time (48 or 72h) and so am...

04 January 2022 581 2 View

Why my protein is precipitating after purification?

Hello, I am trying to purify a recombinant his-tagged protein (MW: 29.5 kd, pI:5.7, mostly composed of beta strands). It has been expressed from BL21(DE3) competent cell. I am using 50 mM Tris,...

14 December 2021 1,077 5 View

How to carry out modified possion regression in spss/ R ?

i know how to carry out Poisson regression for count variable such as total number of children in spss but not modified Poisson regression

27 May 2020 6,044 0 View

How Training and Development help reshaping economy after pandemic situation?

Specially for different sectors different Training and development activities will boost up economic crisis. even those who lost their job like garments workers how we can utilise them by...

20 May 2020 1,991 3 View

If |Z| v/s θ is plotted, will it look similar to Nyquist plot?

I carry out biosensing using thin film gold electrodes. I measure the impedance magnitude and phase as a funtion of frequency. Will plotting |Z| vs θ be similar to Z' vs Z" (real impedance vs...

25 March 2020 1,226 4 View

I am loosing all my protein when I try to concentrate it. Can you please suggest me a anything about it?

Greetings! I am currently working with a kinase name Microtubule affinity regulating kinase 2( MARK2). Every time I purified this protein, I have never got a good yield. Usually after...

12 February 2020 1,798 2 View

Can anyone please suggest me an alternative of Thioanisol at cleavage/micro-cleavage cocktail?

Greetings! I am now working on a F-moc based peptide synthesis having following sequence: GFARVYMSRSSGWERPSGGNVKCKIGSTENLK (N terminal to C-terminal) For the cleavage/micro-cleavge, I need to...

09 February 2020 6,467 6 View

How can I prepare virus for a TEM or SEM imaging?

I have virus (viral hemorrhagic septicemia virus) in suspension and the experiment will not involve cells. What level of TCID50 is preferred?

11 August 2024 3,115 1 View

Hello researchers Is this a random laser or just fluorescence?

I am using Rhodamine6G as gain medium and silver nanoparticles as scatterers on a microscope slide and laser input 532 nm comes from above.

09 August 2024 9,894 2 View

Is there anyone with experience in TEM analysis who can assist with a manuscript for an upcoming journal?

Hello dear colleagues, We have prepared a manuscript on NiTi-based alloys and are seeking a second opinion on our current TEM results. If you are a Ph.D. holder with experience in TEM and have...

07 August 2024 9,563 0 View

Weak DAPI staining after immunohistochemistry - how to improve?

After immunohistochemistry of previously fixed in PFA and EtOH and then frozen 20 μm sections of zebrafish brain, DAPI staining is very weak (right) compared to the same sections stained without...

05 August 2024 9,637 2 View

Are there any commercially available Donkey anti-Alpaca secondary antibodies?

Are there any fluorescently labeled anti-Alpaca secondary antibodies raised in Donkey? So far I have only been able to find anti-Alpaca secondaries raised in Goat. Or is this not possible due to...

04 August 2024 4,255 1 View

Why results of ROS flurescence are negative as there was no bacteria within?

Hello. I am working on ROS production of two systems: system A is cerium oxide and hydrogen peroxide, system B is cerium oxide nanoparticle, hydrogen peroxide and potassium bromide. I did some...

04 August 2024 5,974 3 View

Which distribution type should I use when calculating the average particle size from TEM image? and how to calculate the error ?

average particle size calculation from TEM

04 August 2024 2,921 1 View

Is it necessary to covary exogenous constructs in a structural model?

I am working on a SEM model where i have 7 latent variables (6 exogenous and 1 endogenous). In AMOS when I co-vary the exogenous constructs, only 2 paths are coming significant out of 6. But when...

03 August 2024 6,028 4 View

How to draw the five chelate rings of [Co(EDTA)]- on this picture?

Is this circle one of the rings?

03 August 2024 5,988 0 View

How to calculate the molar proportions of the oxides from the XRF analyses?

02 August 2024 2,565 2 View