How to carry out modified possion regression in spss/ R ?

28 May 2020 0 6K Report

i know how to carry out Poisson regression for count variable such as total number of children in spss but not modified Poisson regression

Badges
Science topic

Similar topics
Statistics
Survey

More Mosammat Nahar's questions See All

InderScience submission Help?

In the InderScience submission, I need the names and details of 4 international experts (I am from India, so at least 2 must be from outside country) I am trying to submit an article that is based...

11 March 2024 9,402 0 View

How to solve big size cloning (5kb insert into 4.3kb vector) ?

Hello I am doing 5kb cloning. But unfortunately I am getting band in 3kb,can anyone tell me what is the exact reason to get at 3kb band? I have made primer in 4 fragment (approximately 1.25kb for...

07 June 2022 6,900 0 View

Why my protein is precipitating after purification?

Hello, I am trying to purify a recombinant his-tagged protein (MW: 29.5 kd, pI:5.7, mostly composed of beta strands). It has been expressed from BL21(DE3) competent cell. I am using 50 mM Tris,...

14 December 2021 1,077 5 View

How Training and Development help reshaping economy after pandemic situation?

Specially for different sectors different Training and development activities will boost up economic crisis. even those who lost their job like garments workers how we can utilise them by...

20 May 2020 1,991 3 View

I am loosing all my protein when I try to concentrate it. Can you please suggest me a anything about it?

Greetings! I am currently working with a kinase name Microtubule affinity regulating kinase 2( MARK2). Every time I purified this protein, I have never got a good yield. Usually after...

12 February 2020 1,798 2 View

Can anyone please suggest me an alternative of Thioanisol at cleavage/micro-cleavage cocktail?

Greetings! I am now working on a F-moc based peptide synthesis having following sequence: GFARVYMSRSSGWERPSGGNVKCKIGSTENLK (N terminal to C-terminal) For the cleavage/micro-cleavge, I need to...

09 February 2020 6,467 6 View

How to do apparatus setup for a photoaffinity labelling assay?

Our lab need to perform a photo-affinity labelling experiment for the first time. We do not have any sort of previous experience for this type of experiment and we are looking for how to set up...

20 August 2019 9,297 0 View

How can I increase HCO3 in Natural drinking water?

If the HCO3 concentration is low in natural water, then how can I increase HCO3 concentration

01 February 2016 3,740 8 View

Sterol staining in yeast ?

I am looking for alternative of Filipin staining for sterols which have higher or lower affinity to specific kind of sterols. Thanks

07 October 2015 8,789 0 View

How can I store in scientific way whole lettuce leaves after inoculation of E. coli O104 to see the survivability of that strain of E. coli?

I inoculated E.coli O104 in 6 whole lettuce (iceberg) leaves to see the survibality. I want to do 3 days interval sampling. Now I cannot understand whether I can keep individual leave in separate...

07 July 2015 4,864 3 View

GC-MS retention index prediticon?

Hello experts, Does anyone know any free software about retention index prediction ?

08 August 2024 7,403 2 View

Is there an alternative to a multinomial regression which allows the DV to be non mutually exclusive?

I am trying to analyse data from a survey examining what variables affect teachers perceived barriers to incorporating technology into their classroom. I have 5 predictor variables however my DV...

06 August 2024 1,752 3 View

In order to run Multinomial Logistic Regression, is it required that the data be in the long format?

I am using unit level data (IHDS round 2) & Stata 17

06 August 2024 5,725 2 View

Why do we equate male and female arousal?

Women, on the other hand, can become physically aroused (increased blood flow in the reproductive organs) without becoming psychologically aroused even in the slightest. (Robert Weiss)

05 August 2024 9,537 2 View

Why wait for a doctor's visit when you can become the guardian of your child's health today?

Join our exclusive WhatsApp group and access the latest research-based videos on children's health! Discover the hidden toxins and other risks that may harm your kids, and learn the best practices...

04 August 2024 1,264 0 View

Ready to take control of your child's health and well-being?

Join our exclusive WhatsApp group and gain access to the latest research-based videos on children's health! Uncover the hidden toxins and other risks that may threaten your kids, and equip...

04 August 2024 5,895 0 View

I need the datasets of Microgrid for system identification?

Hi I am working on data driven model of the microgrid, for that, i need the reliable datasets for the identification of MG data driven Model. Thanks

02 August 2024 5,748 4 View

Should I remove an item from a scale to raise Cronbach's alpha and McDonald's omega or is it better to leave it if they are both over .7 already?

Hello! I have this scale which had 10 items initially. I had to remove items 8 and 10 because they correlated negatively with the scale, and then I removed item 9 because Cronbach's alpha and...

01 August 2024 4,606 7 View

Talking therapies for bipolar, psychology?

what is the best research evidence for psychological interventions for Bipolar?

01 August 2024 6,023 2 View

Normality assumption for linear regression is The assumption of normality is whether for residual errors or predictor variavble?

When we conduct linear regression, there are several assumptions. The assumption of normality is whether the residual errors are normally distributed, not whether a predictor is normal?

31 July 2024 6,164 3 View