Dear all i am trying to download a sequence of Gene (FAD2-1A) from Gene bank.

Paul Rutland

GenBank

Send:

Glycine max FAD2-2 microsomal omega-6 desaturase mRNA, complete cds

GenBank: L43921.1

FASTA Graphics

Go to:

LOCUS SOYMO6DA 1556 bp mRNA linear PLN 24-MAY-1996

DEFINITION Glycine max FAD2-2 microsomal omega-6 desaturase mRNA, complete

cds.

ACCESSION L43921

VERSION L43921.1

KEYWORDS microsomal protein; omega-6 desaturase.

SOURCE Glycine max (soybean)

ORGANISM Glycine max

Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;

Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;

Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae;

Phaseoleae; Glycine; Soja.

REFERENCE 1 (bases 1 to 1556)

AUTHORS Heppard,E.P., Kinney,A.J., Stecca,K.L. and Miao,G.H.

TITLE Developmental and growth temperature regulation of two different

microsomal omega-6 desaturase genes in soybeans

JOURNAL Plant Physiol. 110 (1), 311-319 (1996)

PUBMED 8587990

FEATURES Location/Qualifiers

source 1..1556

/organism="Glycine max"

/mol_type="mRNA"

/db_xref="taxon:3847"

/clone="FAD2-2"

/tissue_type="epicotyl"

CDS 85..1236

/codon_start=1

/product="microsomal omega-6 desaturase"

/protein_id="AAB00860.1"

/translation="MGAGGRTDVPPANRKSEVDPLKRVPFEKPQFSLSQIKKAIPPHC

FQRSVLRSFSYVVYDLTIAFCLYYVATHYFHLLPGPLSFRGMAIYWAVQGCILTGVWV

IAHECGHHAFSDYQLLDDIVGLILHSALLVPYFSWKYSHRRHHSNTGSLERDEVFVPK

QKSCIKWYSKYLNNPPGRVLTLAVTLTLGWPLYLALNVSGRPYDRFACHYDPYGPIYS

DRERLQIYISDAGVLAVVYGLFRLAMAKGLAWVVCVYGVPLLVVNGFLVLITFLQHTH

PALPHYTSSEWDWLRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATK

AIKPILGEYYRFDETPFVKAMWREARECIYVEPDQSTESKGVFWYNNKL"

ORIGIN

1 cccccctctc tctcaccctc ctcttcacac attttctgtg cgctctaaca aacattcctg

61 ttcacacttt cagattgtgt gttgatgggg gcgggtggcc gaactgatgt tcctcctgcc

121 aacaggaagt cagaggttga ccctttgaag cgggtgccat ttgaaaaacc tcagtttagt

181 ctcagccaga ttaagaaggc cattccacct cactgtttcc agcgctctgt tctccgctca

241 ttctcctatg ttgtttatga cctcaccata gccttctgcc tctattatgt tgccacccat

301 tacttccacc tccttcccgg tcctctctct ttccgtggca tggcaatcta ttgggctgtc

361 cagggttgca tccttactgg tgtttgggtc attgcccatg agtgtggtca ccatgcattc

421 agtgactacc agctgcttga tgatattgtt ggccttatcc tccactccgc tctcctagtc

481 ccgtactttt catggaaata cagccatcgc cgtcaccact ccaacactgg ttctcttgag

541 cgggatgaag tatttgtgcc aaagcagaag tcctgtatca agtggtactc taaatacctt

601 aacaatcctc caggcagagt cctcactctt gctgtcaccc tcacacttgg ttggcccttg

661 tacttggctt taaatgtttc tggaaggcct tatgatagat ttgcttgcca ctatgaccca

721 tatggtccca tttactctga tcgtgaacga cttcaaatat atatatcaga tgcaggagta

781 cttgcagtag tctatggcct tttccgtctt gccatggcaa aaggacttgc ctgggtggtg

841 tgtgtttatg gagttccatt gctagtggtc aatggatttt tggtgttgat tacattcttg

901 cagcatactc accctgcatt gccacattac acttcctctg agtgggactg gttgagagga

961 gctttagcaa cagtggatag agattatgga atcctgaaca aggtcttcca taatattaca

1021 gacactcatg tagcacatca cttgttctcc acaatgccac attatcatgc aatggaggct

1081 acaaaggcaa taaaacccat tttgggagag tattatcggt ttgatgagac tccatttgtc

1141 aaggcaatgt ggagagaggc aagagagtgt atttatgtgg agccagatca aagtaccgag

1201 agcaaaggtg tattttggta caacaataag ttgtgatgat taatgtagcc gaggcttctt

1261 tgaactttcc cttgtgactg tttagtatca tggttgctta ttgggaataa ttttgttgaa

1321 ccctgatgtt ggtagtaagt atctagacag ttgcatagcg gttttgttta cagaataaga

1381 tatagcctct ctgaacagtt tgattattgc accatggttt gcaatcggtg catgtcgacc

1441 aagtttctca agactgtgga gaagcttatt cttgttccag ttcttgaatc caagttgtta

1501 ccgtattctg ttattattga cttagaatcc ttaacctttt ctgctgtttt ctcaaa

Can linear DNA be used as template for site-directed mutagenesis?

Which is suitable for use with Python? MySQL or SQL Server?

How to remove the residual PDMS on the silicon mold?

What are the important topics in the field of Artificial Intelligence in Business world?

Is IMPACT FACTOR justified in case of Taxonomy?

Why tick's salivary gland extract didn't run in the gel (SDS PAGE )??

Why CNN algorithm performs well in Network Intrusion Detection based on some recent resources?

Is it possible to set a breakpoint at a specific DYNAMIC instruction using the GNU Debugger (GDB)?

How to measure the pH of Peat Soil?

How to Measure Consumer Willingness To Change from petroleum-fueled vehicle to electric vehicle?

How to compare two groups with only two measurements?

Enhanced Yellow Fluorescent Protein (Aequorea victoria) DNA sequence?

What kind of fluid could I use for a pitfall trap that also does not invalidate molecular testing?

What's the best way to measure growth rates in House sparrow chicks from day 2 to day 10?

Do we need to write protocol for a second study of a systematic review that has been registered and published?

How to increase a model accuracy ?

Do I need to do linear regression before running mediation analysis using PROCESS MACRO by Hayes ?

Sample dilution for quantitative analysis using ELISA?

Is There Any Feasible Method To Test Fluorescent Compounds Other Than Fluorescence Spectrometers ??

How to calculate average trend in maximum annual NDVI from MODIS?