I want to detect whether there's kinetochore formation on a possibly neocentromere, doest crest staining contain anti-kinetochore antibody and allow me to do that?
Can someone suggest me a good anti-kinetochore antibody? Thanks
Anti-Kinetochore antibody (ab254630)
£315 Product
Size
100 µl
Product name
Anti-Kinetochore antibody
See all Kinetochore primary antibodies
Description
Rabbit polyclonal to Kinetochore
Host species
Rabbit
Tested applications
Suitable for: ICC/IF, IHC-Pmore details
Species reactivity
Reacts with: Human
Immunogen
Recombinant fragment corresponding to Human Kinetochore aa 581-693.
Sequence:
VKMLESLLNSMSASVSLQKLCPWFKNDVIPFVRRTVPEGQIILAKWLEQA ARNLELTDKANWPENGLQLAEIFFTAEKTDELGLASSWHWISLKDYQNTE EVCQLRTLVNNLR
Database link: P50748
Run BLAST with BLAST the sequence with ExPASy
Run BLAST with BLAST the sequence with NCBI
Positive control
IHC-P: Human testis tissue. ICC/IF: U-251 MG cells
ok thanks will try
Hiiiii everyone! I have an enquiry on statistical analysis. I was looking for many forum and it's still cannot solve my problem. I want to compare means of two groups of data but only with two...
03 March 2021 8,796 3 View
I would like to create a small guide containing the meanings of the names .. Thanks to everyone who cooperates with me in achieving it.
03 March 2021 5,266 4 View
Is There Any Feasible Method To Test The Efficiency Of Fluorescent Compounds Other Than UV Spectrometers ? Suggestions Would Be Appreciated !
02 March 2021 5,785 3 View
How to do Piezoelectric coupling in ANSYS-APDL or COMSOL between tapered substrate and rectangular piezoelectric patch? Piezoelectric coupling between the rectangular substrate and rectangular...
02 March 2021 9,833 3 View
I am going to have 3 different probes in my qPCR work that I am going to do. But I realized that the machine we have in the lab is a Rotor-Gene Q 2plex HRM Platform, saying it has green, yellow,...
01 March 2021 8,544 1 View
Is the electropolymerisation of polyaniline coating over stainless steel (SS) via Cyclic voltammetry technique is really adherant? Else how to improve the adhesion of the coating, whether any...
01 March 2021 8,220 2 View
I have created an Ice 1h crystalline structure and an Aluminium substrate structure and equilibrated both at 250K. Now I need to bring them together in a way that an adhesive bond is created....
01 March 2021 3,325 2 View
Does anyone have the experience of using Taq Man probes in the QIAGEN Rotar- Gene qPCR machine?
01 March 2021 5,311 1 View
When explaining substitution models, the substitutions are expressed as Q matrix. Why is the sum of the elements in a row zero?
28 February 2021 3,864 3 View
Hello, I have simulated a single battery cell using Thevenin equivalent circuit. For a battery pack, I have a large number of cells connected in series and parallel connections. Is there any way...
28 February 2021 2,116 1 View
Hi all, I am validating a polyclonal antibody raised against human ANT4, through WB and ICC. In most of my controls, the antibody shows very little off-target binding, but when I pre-incubate the...
03 March 2021 5,999 3 View
Santa Cruz now recommends this new antibody (F-10) but I can't find a publication using this reference. I'm working on human et non human primate hypothalamus and so far, it doesn't work. Is...
02 March 2021 10,003 2 View
Hello Everyone. Currently I am working to characterize macrophages in the myocardium after ischemia-reperfusion injury in rats. Due to the low total cell number isolated from rat hearts I can...
01 March 2021 3,867 3 View
We have been using Thermo Fisher anti-cardiac Troponin T antibody for immunofluorescence staining in FFPE mouse heart sections but it was recently discontinued. The literature shows it to be the...
01 March 2021 4,937 1 View
I am looking at the ATP1A2 (Sodium/Potassium ATPase alpha subunit 2) in two human neuronal cell lines. Expression levels of this protein seems to be almost equal when detected by one antibody....
01 March 2021 3,607 3 View
Hello, I was just wondering how does a antibody have full intact antibody + half antibody? Is it because of the drug conjugation?
28 February 2021 1,577 1 View
Interested to stain mice brain tissue with WGA 488 conjugate, appreciate if anyone willing to offer me some guidance or suggestions! Thank you!
28 February 2021 3,951 2 View
I am looking for anti-nuclear antibody (ANA) and anti-Phospholipid antibody ELISA kit for Non Human Primate serum samples. Any suggestions highly appreciated. Thank you.
28 February 2021 6,512 3 View
When you use RIA, with a control the unknown sample with antibodies, you bare in mind the binding sites of the antibodies. However you still need to measure labelled antigen (radioactive) and not...
28 February 2021 2,133 3 View
I am looking for a good progesterone antibody to quantify levels of progesterone in zebrafish. Applications would be ELISA, and immunohistochemistry.
28 February 2021 5,929 2 View