I am studying a kind of biological medicine. I need the sequence of CD3 antibody in my research. Who can tell me the sequence of antibody
hi
you can find okt3 or CD3 antibody protein sequence from this link :
Sequences
>Muromonab-CD3 light chain QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAH FRGSGSGTSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEINRADTAPTVSIFPPS SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>Muromonab-CD3 heavy chain QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNY NQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSA KTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
https://www.drugbank.ca/drugs/DB00075
good luck
thank you
Hi, Recently I was running VASP to calculate the spontaneous polarization of my alloy structure. I followed the instructions in this PDF wrote by Dr. Nabin (Nabaraj) Pokhrel, below is my INCAR...
07 August 2024 486 5 View
Hello everyone, I am currently using washed human platelets to stain Annexin V as a procoagulant marker. Additionally, I am staining with PerCP-CD61 to identify platelet cells. So far, I have...
29 July 2024 8,624 1 View
The catalytic effect of retained austenite refers to the phenomenon wherein quenching steels with a small amount of retained austenite, when subjected to tempering at a specific temperature...
27 July 2024 8,508 0 View
I am a beginner with ImageJ and would like to know how to quantify fluorescence images of platelets taken with a fluorescence microscope at 40x and 100x magnification. If you could provide...
11 July 2024 1,464 7 View
I measured the fatty acids in the fish, using the internal standard method in the national standard method, I first extracted the fish oil with cable extraction, please ask me how many grams of...
02 July 2024 900 1 View
Who could give me an online access to Mandarin Ducks and Butterflies: Popular Fiction in Early Twentieth-Century Chinese Cities by Perry Link?
27 June 2024 1,589 0 View
Hello everyone! I'm conducting a study on how people choose between different shopping channels in today's omnichannel retail environment, and I need your input! Whether you prefer shopping...
26 June 2024 5,275 0 View
Based on my previous question on ReseachGate, I transfected the gene of Norepinephrine Transporter into human colon cells. The sequence of the vector has been confirmed correct. Usually, after...
19 June 2024 1,144 3 View
I wanted to check the expression of a transfected membrane protein called NET, so I decided to check the mRNA by RT-PCR. After three months of culture selection (the cells were still not...
18 June 2024 5,822 3 View
Hi all, Last week, I seeded cells from the same sample into 4 wells (fibroblasts; 300000 cells/well; 1ml/well). well-1 and well-2 are for qRT-PCR test; well-3 and well-4 are for Western blot...
09 June 2024 2,482 3 View
Can anyone share any reference that gives mouse specific CD3 antibody sequence. I have been searching for this since few days and no luck. Thank you very much
08 August 2024 9,157 4 View
I'm working on selecting antibodies against a recombinant protein that has a His-tag. My idea is to first bind the recombinant protein to a HisTRAP column and then use this column for an affinity...
07 August 2024 505 3 View
We have a lateral flow test on Sartorius 140 NC. The conjugate is gold-monoclonal antibody. Using different control lines (GAM, protein A, protein G) we get a very strong leading edge with reduced...
31 July 2024 4,510 3 View
I am performing IgG purification and I have to show my results on SDS-PAGE. I use 10% tris glycine gel and prepare the samples under non reducing conditions. I am new to antibodies and therefore...
23 July 2024 6,664 6 View
I have immunized BalB/C mice with a protein using the intradermal (ID) method with Complete Freund's Adjuvant (CFA) and Incomplete Freund's Adjuvant (IFA), following a 14-day interval and three...
22 July 2024 9,160 2 View
Hello, I recently stained my cells with an Arf6 antibody. The healthy control looks pretty normal, while the disease group cells have abnormally large black structures in the cell body. Has anyone...
21 July 2024 1,044 1 View
It was assumed that 4E8 T cells should be isolated and activated using plate-bound anti-human CD3, after which would be used for a genome-wide CRISPR screen. (Ref: Genome-wide CRISPR Screens in...
17 July 2024 3,371 0 View
Hi there, I'd like to use immunocytochemistry to determine a surface protein expression on mouse cell. The primary antibody I have is mouse anti mouse, and the secondary antibody I have is goat...
15 July 2024 6,008 5 View
I'm currently using Roche anti-DIG-AKP Fab fragments to perform Southern Blot assays, but this reagent is delayed since november last year. It's anybody facing the same problem? If so, how are you...
15 July 2024 6,668 0 View
Dear all, I'm going to radiolabel antibodies. So first of all, I'll remove excipients using the centrifugation method with amicon. Once I'm done, how do I calculate/measure the concentration of...
14 July 2024 3,106 3 View