Polymer Chemists' Network | Contact experts in Polymer Chemistry to get answers
1,189 views 2,319 posts
Questions related to Polymer Chemistry
How does elongation at break and strain% behave with an increase in crosslinking density for the rubbers (elastomers)? Is that random or can it be measured?
31 March 2020 9,691 10 View
I am working on MIP (Molecularly imprinted polymer) electrode for detection some biological molecules. For this way, I need to elctropolymerize a conductive polymer on the electrode surface along...
29 March 2020 3,646 5 View
Can someone please simulate and explain these protein-ligand interactions for each of the ligands: Please help me, it's urgent. Protein 5I08 : https://www.rcsb.org/structure/5I08 Ligands 1R42 :...
25 March 2020 4,245 4 View
I have synthesized covalent organic frameworks (COF) with high crystallinity and a natural problem of COF's is that they are not soluble in solvents. However, I get a slightly good dispersion in...
18 March 2020 6,629 2 View
What is the maximum thickness of absorbing layer in thin film solar cell technology?
14 March 2020 4,845 4 View
I did a BET test and pore size distribution (PSD) was calculated from BJH method the during the test. And now I want to calculate PSD according to DFT method. How can I do that?
13 March 2020 4,022 10 View
The IR spectra attached is of a fouled cat shark (S. canicula) egg case, with a very intense peak at 1405cm-1. I've considered O-H stretching or S=O bending, has anyone seen a similar peak or does...
05 March 2020 3,440 4 View
NBR rubber shows the steady curve on moving die rheometer (MDR) S curve with torque increasing endlessly even after 1 hr. With an increase in max torque value, T90 also increases. How do I know...
03 March 2020 3,175 4 View
Just heating and magnetic stirring @90deg. also won't help much in dissolving, even keeping for more than 12 hours.
01 March 2020 8,133 5 View
I am going to design and build a set-up for measuring the thermal conductivity of polymers, nanocomposites, and foams. I am looking for a relatively affordable technique. Please share with me if...
21 February 2020 7,059 5 View
Dear All, I am trying to synthesize TiO2 sol using the hydrolysis technique with Titanium Butoxide as a precursor, the reference as attached below. TiO2 Nanocrystals Grown on Graphene as...
19 February 2020 777 5 View
I am in need of ASTM G99-17 for testing a sample for wear.
18 February 2020 8,400 7 View
I have a recipe for emulsion co-polymerization, which contains : 1) surfactant, 2) monomer and 3) its co-monomer, 4) initiator and 5) activator. From these, i have a sheet to calculate mass for...
15 February 2020 5,220 3 View
Dear all, I would be very grateful if one of you can detect the error of the following protocol to make the standard curve for measuring the activity of Pectinase, since the results obtained were...
14 February 2020 7,901 5 View
In accordance with the conventional capacitor characteristics, pseudocapacitance was developed. However, several research reports presenting cyclic voltammetry curves (as shown in the attached...
11 February 2020 1,453 0 View
Greetings! I am now working on a F-moc based peptide synthesis having following sequence: GFARVYMSRSSGWERPSGGNVKCKIGSTENLK (N terminal to C-terminal) For the cleavage/micro-cleavge, I need to...
10 February 2020 6,446 6 View
02 February 2020 2,385 2 View
I know you can influence crystallinity during produciton but can it still be influenced aftwards?
22 January 2020 8,315 8 View
Hello All, I want to compare the surface roughness among different samples from confocal microscope (TCS-SP8, Leica), for example, to get the Rq or SA value from the surface. Does anyone know the...
20 January 2020 3,047 6 View
using carboxyl modified latex edc nhs mediated coupling method is giving very law reaction . is there other latex particles to be used to develop latex reagent or latex modifiaction to couple...
17 January 2020 2,413 0 View
In making Silicone 3D models, after curing, the final silicone product sometimes it turned out clear and the other times turned out opaque. How to control the level of transparency so it looks...
17 January 2020 7,786 1 View
I used >600 degree C for the preparation of Carbon frameworks at 5 degree C /min heating rate for 1 hour using Ar gas as inert atmosphere. In literature it is confusing , many reports have...
07 January 2020 8,169 4 View
I want to dissolve Potassium tert-butoxide in tert-Butanol for the preparation of 1M solution. but, Potassium tert-butoxide does not dissolve in tert-butanol. In accordance with references,...
06 January 2020 7,626 8 View
I'm seeking about a real and simple method in the synthesis of isopropyl magnesium chloride
03 January 2020 1,773 3 View