Khairun Nahar

3 Questions 3 Answers 0 Followers

Questions related from Khairun Nahar

Why my protein is precipitating after purification?

Hello, I am trying to purify a recombinant his-tagged protein (MW: 29.5 kd, pI:5.7, mostly composed of beta strands). It has been expressed from BL21(DE3) competent cell. I am using 50 mM Tris,...

15 December 2021 1,056 5 View

I am loosing all my protein when I try to concentrate it. Can you please suggest me a anything about it?

Greetings! I am currently working with a kinase name Microtubule affinity regulating kinase 2( MARK2). Every time I purified this protein, I have never got a good yield. Usually after...

13 February 2020 1,762 2 View

Can anyone please suggest me an alternative of Thioanisol at cleavage/micro-cleavage cocktail?

Greetings! I am now working on a F-moc based peptide synthesis having following sequence: GFARVYMSRSSGWERPSGGNVKCKIGSTENLK (N terminal to C-terminal) For the cleavage/micro-cleavge, I need to...

10 February 2020 6,446 6 View