4 Questions 3 Answers 0 Followers
Questions related from Khairun Nahar
Hello, I am trying to purify a recombinant his-tagged protein (MW: 29.5 kd, pI:5.7, mostly composed of beta strands). It has been expressed from BL21(DE3) competent cell. I am using 50 mM Tris,...
15 December 2021 1,071 5 View
Greetings! I am currently working with a kinase name Microtubule affinity regulating kinase 2( MARK2). Every time I purified this protein, I have never got a good yield. Usually after...
13 February 2020 1,786 2 View
Greetings! I am now working on a F-moc based peptide synthesis having following sequence: GFARVYMSRSSGWERPSGGNVKCKIGSTENLK (N terminal to C-terminal) For the cleavage/micro-cleavge, I need to...
10 February 2020 6,462 6 View
Our lab need to perform a photo-affinity labelling experiment for the first time. We do not have any sort of previous experience for this type of experiment and we are looking for how to set up...
21 August 2019 9,287 0 View